PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011707m
Common NameCARUB_v10011707mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 442aa    MW: 49930.2 Da    PI: 6.1266
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011707mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.47.7e-142670348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W++eEd +l + ++++G+++W+ Ia+++   ++  qc+ rw++yl
  Carubv10011707m 26 SWSQEEDVILREQITLHGTENWAIIASKFK-DKSTRQCRRRWYTYL 70
                     6****************************9.*************97 PP

2Myb_DNA-binding42.81.2e-1376119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
  Carubv10011707m  76 RGGWSPEEDMLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 119
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3491970IPR017930Myb domain
SMARTSM007172.9E-122372IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-2424117IPR009057Homeodomain-like
CDDcd001679.79E-122670No hitNo description
PfamPF139211.4E-142787No hitNo description
Gene3DG3DSA:1.10.10.602.9E-192778IPR009057Homeodomain-like
PROSITE profilePS5129419.92371125IPR017930Myb domain
SMARTSM007172.0E-1475123IPR001005SANT/Myb domain
CDDcd001672.14E-1079120No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1879124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MEDTKKKKKK NINNQDSKKK ERHIVSWSQE EDVILREQIT LHGTENWAII ASKFKDKSTR  60
QCRRRWYTYL NSDFKRGGWS PEEDMLLCEA QRVFGNRWTE IAKVVSGRTD NAVKNRFTTL  120
CKKRAKHEAL AIENSNSNTK RILFLDGIST PQKAENEAPI AKKMRRSQIL DLTDMISING  180
KAEPCMNQNI RSPFSVLACN AIGIDGLEEQ NQISNVKESD GEGMFLKKDD PKVTALMQQA  240
ELLSSLAQKV NADNTEQSME NAWKVLQEFL NKGKENDLFR YGIPDIDFKI EEFKDLIEDL  300
RSGYEDNQQS WRQPGLHDSP ASSEYSSGST VMLDQSGDRT QPSPSDIQTE QKQVVEELLS  360
ACDVPRNPEE NLPISGEEKF SSPIQVTPLF RSLADGIPSP QFSESERSFL LKTLGIESSS  420
PCPSANPSKP PPCKRVLLHS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-262712510108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719820.0AF371982.2 Arabidopsis thaliana putative transcription factor MYB124 (MYB124) mRNA, complete cds.
GenBankBT0261260.0BT026126.1 Arabidopsis thaliana.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303665.10.0hypothetical protein CARUB_v10011707mg
TrEMBLR0II750.0R0II75_9BRAS; Uncharacterized protein
STRINGAT1G14350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.20.0MYB family protein